DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and tnfaip1

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001016809.1 Gene:tnfaip1 / 549563 XenbaseID:XB-GENE-943703 Length:319 Species:Xenopus tropicalis


Alignment Length:269 Identity:173/269 - (64%)
Similarity:204/269 - (75%) Gaps:12/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRDG 82
            ::|::|||||.|||||:..||: :||||.||||||||||||.||||||||||.|||.|||||||.
 Frog    30 NKYIRLNVGGCLYYTTVQVLTR-HDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGSILNYLRDD 93

  Fly    83 TVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEP-KPICRIPLITSQKEEQLLLSVSLK 146
            |:.||::..|:.||:||||||.|..|...|:.||....:. :.:|.||:|||.|||:.|:..|.|
 Frog    94 TITLPKSRHEVKELMAEAKYYLIQGLVDKCQAALQDKNDTYEAVCNIPIITSPKEEEKLIESSAK 158

  Fly   147 PAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIKDVIGPSEICCWSFYGHGKK 211
            |.|.|:..|.||||||||.||||||||||||||||||||.|:|||||||| .|||||||||.|:|
 Frog   159 PVVKLLYNRSNNKYSYTSNSDDNLLKNIELFDKLSLRFNGRVLFIKDVIG-DEICCWSFYGQGRK 222

  Fly   212 VAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLYENRNAPDQELMQATSSARVGSASGTSIN 276
            :||||||||||||::|.|||||||||||||||.|||||....||..|::|||..|         :
 Frog   223 LAEVCCTSIVYATEKKQTKVEFPEARIYEETLNVLLYETPRVPDNSLLEATSRTR---------S 278

  Fly   277 QYTSDEEEE 285
            |.:..|::|
 Frog   279 QASHSEDDE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 65/96 (68%)
BTB_2 21..112 CDD:280393 62/90 (69%)
tnfaip1NP_001016809.1 BTB_POZ_TNFAIP1_BACURD2 29..132 CDD:349709 66/102 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2603
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I2120
OMA 1 1.010 - - QHG48414
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 1 1.000 - - otm49515
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.