DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and kctd9a

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001013585.2 Gene:kctd9a / 541442 ZFINID:ZDB-GENE-050320-147 Length:389 Species:Danio rerio


Alignment Length:151 Identity:51/151 - (33%)
Similarity:72/151 - (47%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSESMSGDHKILLKGHSSQYLKLNVGGHLYYTTIGTL-TKNNDTMLSAMFS-----GRMEVLTDS 59
            ||:.:||.|        :.:|.||:||.|:.||..|| :|..|:||:.||.     |..:   |.
Zfish    79 MSDDISGSH--------TDWLTLNIGGRLFTTTRSTLVSKEPDSMLAHMFREKDVWGNKQ---DE 132

  Fly    60 EGWILIDRCGNHFGIILNYLRDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEP-- 122
            .|..||||...:|..||||||.|.:.:.: ...:..:|.||:::.|.:||...|.|:.....|  
Zfish   133 RGAFLIDRSPEYFEPILNYLRHGQIIIND-GINLLGVLEEARFFGIEQLAEQLEVAIKNSHPPED 196

  Fly   123 ------KPICRIPLITSQKEE 137
                  |...|..|.|..|.|
Zfish   197 HSPLSRKEFVRFLLATPTKSE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 37/96 (39%)
kctd9aNP_001013585.2 KHA 2..66 CDD:340593
BTB_POZ_KCTD9 89..188 CDD:349677 38/102 (37%)
YjbI 222..377 CDD:440968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.