DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and KCTD4

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_940686.2 Gene:KCTD4 / 386618 HGNCID:23227 Length:259 Species:Homo sapiens


Alignment Length:96 Identity:39/96 - (40%)
Similarity:56/96 - (58%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KGHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNY 78
            |...|..:.|||||:||.|...||||..||.|..:.:|::....|::|...|||.|..|..:||:
Human    28 KNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNF 92

  Fly    79 LRDGTVPLPETNKEIAELLAEAKYYCITELA 109
            ||:|.:.|||..:|...|..||:::.:..||
Human    93 LRNGELLLPEGFRENQLLAQEAEFFQLKGLA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 37/89 (42%)
KCTD4NP_940686.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
BTB_POZ_KCTD4 34..119 CDD:349673 35/84 (42%)
KCTD4_C 138..259 CDD:437155
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.