DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and Kcnrg

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001034194.1 Gene:Kcnrg / 328424 MGIID:2685591 Length:264 Species:Mus musculus


Alignment Length:86 Identity:29/86 - (33%)
Similarity:44/86 - (51%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRDGTVPLP 87
            |||||.::.|...||.:...:.|:.|..||.:.....:|.|.:||.|..|..||::||:..:.||
Mouse     9 LNVGGRIFTTRPSTLKQFPASRLAGMLDGRDQEFKTVDGQIFVDRDGALFSFILDFLRNHELLLP 73

  Fly    88 ETNKEIAELLAEAKYYCITEL 108
            ....:...|..||.:|.:..|
Mouse    74 SDFADHHRLQREALFYELDSL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 29/86 (34%)
KcnrgNP_001034194.1 BTB_POZ 5..100 CDD:453885 29/86 (34%)

Return to query results.
Submit another query.