DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and tnfaip1

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_956093.1 Gene:tnfaip1 / 327399 ZFINID:ZDB-GENE-030131-5610 Length:320 Species:Danio rerio


Alignment Length:272 Identity:164/272 - (60%)
Similarity:201/272 - (73%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRDG 82
            ::|::|||||:|||:|:..||: .||:|.:||||:||||||.||||||||||.|||.||:|||||
Zfish    39 NKYVQLNVGGNLYYSTLQVLTR-QDTLLRSMFSGKMEVLTDKEGWILIDRCGKHFGSILSYLRDG 102

  Fly    83 TVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICRIPLITSQKEEQLLLSVSLKP 147
            .|.||::.:.|.|||||||||.|..|...|::.|..::| |.:|.||:|||.|||:.|:...::|
Zfish   103 FVNLPKSRQSIMELLAEAKYYQIQGLIDLCQKELQDNKE-KALCVIPVITSPKEEERLIQACVRP 166

  Fly   148 AVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIKDVIGPSEICCWSFYGHGKKV 212
            .|.|:..|.||||||||.||||||||||||:||||.::.|:|||||||| .|||||||||..:|:
Zfish   167 VVKLLYNRGNNKYSYTSNSDDNLLKNIELFEKLSLSYSGRVLFIKDVIG-DEICCWSFYGQHRKL 230

  Fly   213 AEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLYENRNAPDQELMQATSSARVGSASGTSINQ 277
            ||||||||||||::|.|||||||||||||||..||||....||..|::||.         ...|.
Zfish   231 AEVCCTSIVYATEKKQTKVEFPEARIYEETLNALLYETLPIPDYSLLEATR---------RRTNC 286

  Fly   278 YTSDEEEERTGL 289
            .:..||||...|
Zfish   287 CSHSEEEEAVEL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 61/96 (64%)
BTB_2 21..112 CDD:280393 59/90 (66%)
tnfaip1NP_956093.1 BTB 41..139 CDD:197585 62/98 (63%)
BTB 42..132 CDD:295341 59/90 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575051
Domainoid 1 1.000 218 1.000 Domainoid score I2590
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 361 1.000 Inparanoid score I2159
OMA 1 1.010 - - QHG48414
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 1 1.000 - - otm25829
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.