DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and Tnfaip1

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_891995.1 Gene:Tnfaip1 / 287543 RGDID:3877 Length:316 Species:Rattus norvegicus


Alignment Length:272 Identity:174/272 - (63%)
Similarity:208/272 - (76%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYL 79
            |..::|::|||||.|:|||:..||: :||||.||||||||||||.||||||||||.|||.|||||
  Rat    24 GLGNKYVQLNVGGSLHYTTVRALTR-HDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGTILNYL 87

  Fly    80 RDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEP-KPICRIPLITSQKEEQLLLSV 143
            ||.||.||::.:||.||:||||||.|..|...|:.||...::. :|:|.||:|||.:||..|:..
  Rat    88 RDDTVTLPQSRQEIQELMAEAKYYLIQGLVSLCQAALQDKKDSYQPVCNIPIITSLREEDRLIES 152

  Fly   144 SLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIKDVIGPSEICCWSFYGH 208
            |.||.|.|:..|.||||||||.|||:||||||||||||||||.|:|||||||| .|||||||||.
  Rat   153 STKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIG-DEICCWSFYGQ 216

  Fly   209 GKKVAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLYENRNAPDQELMQATSSARVGSASGT 273
            |:|:||||||||||||::|.|||||||||||||||.|||||....||..|::|||.:|       
  Rat   217 GRKLAEVCCTSIVYATEKKQTKVEFPEARIYEETLNVLLYETPRVPDNSLLEATSRSR------- 274

  Fly   274 SINQYTSDEEEE 285
              :|.:..|:|:
  Rat   275 --SQASPSEDED 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 66/96 (69%)
BTB_2 21..112 CDD:280393 63/90 (70%)
Tnfaip1NP_891995.1 BTB_POZ_TNFAIP1_BACURD2 26..129 CDD:349709 67/103 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..287 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335817
Domainoid 1 1.000 221 1.000 Domainoid score I2522
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I2102
OMA 1 1.010 - - QHG48414
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 1 1.000 - - otm46436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.