DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and KCTD13

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_011544085.1 Gene:KCTD13 / 253980 HGNCID:22234 Length:347 Species:Homo sapiens


Alignment Length:295 Identity:169/295 - (57%)
Similarity:210/295 - (71%) Gaps:26/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRD 81
            :|:|:||||||.|:|||:.||| ..||||.||||||:|||||:.||:||||.|.|||.|||||||
Human    39 NSKYVKLNVGGSLHYTTLRTLT-GQDTMLKAMFSGRVEVLTDAGGWVLIDRSGRHFGTILNYLRD 102

  Fly    82 GTVPLPETNKEIAELLAEAKYYCITELAISCERAL-----------YAHQEPK--------PICR 127
            |:|||||:.:|:.|||.||:||.:..|...|:.||           :..:.||        |:|.
Human   103 GSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQVRAFGVPMPMFLGELPKQQKRETLSPLCL 167

  Fly   128 IPLITSQKEEQLLLSVSLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIK 192
            ||::||.:|||.||:.:.||.|.|:..|.||||||||||||||||||||||||:|||:.|:||:|
Human   168 IPMVTSPREEQQLLASTSKPVVKLLHNRSNNKYSYTSTSDDNLLKNIELFDKLALRFHGRLLFLK 232

  Fly   193 DVIGPSEICCWSFYGHGKKVAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLYENRNAPDQE 257
            ||:| .|||||||||.|:|:||||||||||||::|.||||||||||:||||.:|:||....||..
Human   233 DVLG-DEICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIFEETLNILIYETPRGPDPA 296

  Fly   258 LMQATSSARVGSASGTSINQYTSDEEEERTGLARL 292
            |::||..|.....:|..     .|||.....:.|:
Human   297 LLEATGGAAGAGGAGRG-----EDEENREHRVRRI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 64/107 (60%)
BTB_2 21..112 CDD:280393 60/90 (67%)
KCTD13XP_011544085.1 BTB 42..137 CDD:197585 62/95 (65%)
BTB 43..133 CDD:295341 60/90 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142090
Domainoid 1 1.000 221 1.000 Domainoid score I2618
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2164
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48414
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 1 1.000 - - otm42284
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5106
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.