DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and KCTD2

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_056168.1 Gene:KCTD2 / 23510 HGNCID:21294 Length:263 Species:Homo sapiens


Alignment Length:138 Identity:42/138 - (30%)
Similarity:70/138 - (50%) Gaps:11/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMF---SGRMEVLTDSEGWILIDRCGNHFGIIL 76
            |.::::::|||||..:.||..||.:...:.|..:.   ...::...|..|..||||...:||.||
Human    68 GGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPIL 132

  Fly    77 NYLRDGTVPLPETNKEIAE--LLAEAKYYCITELAISCERALYAHQ---EPKPICRIPLITSQKE 136
            ||||.|.:.:   .||:||  :|.||::|.|..|....:..:..::   ...|:..:..:...:|
Human   133 NYLRHGKLII---TKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQE 194

  Fly   137 EQLLLSVS 144
            |:|...||
Human   195 EELTQMVS 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 35/95 (37%)