DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and Kctd12b

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_780638.1 Gene:Kctd12b / 207474 MGIID:2444667 Length:292 Species:Mus musculus


Alignment Length:97 Identity:36/97 - (37%)
Similarity:53/97 - (54%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGR--MEVLTDSEGWILIDRCGNHFGIILN 77
            |...:.::|||||.:|.|...||.....:.|..|||.:  ..::.|::|...|||.|..|..:|:
Mouse    17 GSFPEIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDNKGRFFIDRDGFLFRYVLD 81

  Fly    78 YLRDGTVPLPETNKEIAELLAEAKYYCITELA 109
            |:||..|.||:...|...|..||:|:.:.|||
Mouse    82 YMRDMQVVLPDHFPECGRLHREAEYFKLPELA 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 35/91 (38%)
Kctd12bNP_780638.1 BTB_POZ_KCTD8-like 19..118 CDD:349676 35/95 (37%)
H1_KCTD12b 174..291 CDD:409027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.