DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and ZC239.16

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494482.1 Gene:ZC239.16 / 191126 WormBaseID:WBGene00022574 Length:155 Species:Caenorhabditis elegans


Alignment Length:162 Identity:52/162 - (32%)
Similarity:84/162 - (51%) Gaps:25/162 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLTKNND---TMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYL 79
            |:.:||:|||.::.|:..||||.:.   |||......::|    ..|.|.|||...||.:|||.:
 Worm     2 SEIIKLDVGGTIFKTSKDTLTKFHSFFKTMLECKTGPKIE----KTGCIFIDRSPKHFELILNLM 62

  Fly    80 RDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICRIPLITSQKEEQL----- 139
            |||.:||||..:|:.||:|||::|.:..|.:.|...|.:.::    .:|....:.|:..|     
 Worm    63 RDGDLPLPEDERELRELMAEAQFYWLDGLVLMCCDKLNSTKK----VQIDQRANTKKYDLSWFFV 123

  Fly   140 -------LLSVSLKPAV--ILVVQRQNNKYSY 162
                   |:.|...||:  ..:|:::|..|.:
 Worm   124 FSIIFLVLVFVYYMPALKGYFIVEKRNKCYLF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 40/99 (40%)
BTB_2 21..112 CDD:280393 39/93 (42%)
ZC239.16NP_494482.1 BTB_2 5..96 CDD:366986 39/94 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.