DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and ZC239.14

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494479.2 Gene:ZC239.14 / 191124 WormBaseID:WBGene00022572 Length:223 Species:Caenorhabditis elegans


Alignment Length:191 Identity:59/191 - (30%)
Similarity:92/191 - (48%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLTKNN---DTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYL 79
            |:.:||:|||.::.|:..||||.|   .|||......::    |..|.|.|||...||.:|||::
 Worm     2 SEIVKLDVGGTIFKTSKSTLTKFNGFFKTMLECDIGLKL----DESGCIFIDRSPKHFDLILNFM 62

  Fly    80 RDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICR-IPLITSQKEEQLLLSV 143
            |||.|.||....::.|||.||::|.:..|...|...:...:.||.:.| ...|.|..:...:|:.
 Worm    63 RDGDVALPNCELKLKELLVEAQFYLLDGLIEMCNSKIMPVEPPKLVGRKFQFIESNAKLLQILAD 127

  Fly   144 SLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLR-FNERI-----LFIKDVIGPS 198
            ..||.:|:         .|...:|  :|..:.|.|....| |.|:.     ::.|:.:.|:
 Worm   128 HQKPLLII---------GYVHNTD--ILLRVSLPDNFDARAFIEKYSDQFDIYFKEHVSPA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 39/99 (39%)
BTB_2 21..112 CDD:280393 38/93 (41%)
ZC239.14NP_494479.2 BTB_2 5..95 CDD:366986 38/93 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3463
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.