DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and fbxb-52

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001309510.1 Gene:fbxb-52 / 187036 WormBaseID:WBGene00019417 Length:334 Species:Caenorhabditis elegans


Alignment Length:174 Identity:35/174 - (20%)
Similarity:64/174 - (36%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LTDSEGWILIDRCGNHFGIILNYLRDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQ 120
            |.|:..|.      ||...||...:..|:.:...:.|..|...:....|:....| |..::....
 Worm   104 LFDTRSWF------NHLMDILQPSKLNTLNVENPSDEFDESKFKMIKKCLKGRKI-CLLSIQRTP 161

  Fly   121 EPKPICRIPLITSQKEE-QLLLSVSLKPAVIL----VVQRQNNKYSYTSTSDDNLL--------- 171
            ..:.|.::..:.|:..| ||..:..|..:.:|    ::|.:::....::.|.:|||         
 Worm   162 RMENILKLVNVFSEANELQLSANEQLDSSQLLAFRQILQMEHHNLYLSNLSLNNLLITRSSVIET 226

  Fly   172 --------KNIELFDK--------------LSLR---FNERILF 190
                    |||.|..|              :.||   ||:.::|
 Worm   227 ENSTLLTEKNINLILKHWIAGLKPELKYLSVQLRGPVFNKELVF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 13/60 (22%)
BTB_2 21..112 CDD:280393 12/55 (22%)
fbxb-52NP_001309510.1 F-box 7..50 CDD:366220
FBA_2 <218..257 CDD:369493 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.