powered by:
Protein Alignment CG10465 and K02F6.6
DIOPT Version :9
Sequence 1: | NP_610165.1 |
Gene: | CG10465 / 35488 |
FlyBaseID: | FBgn0033017 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494290.2 |
Gene: | K02F6.6 / 186909 |
WormBaseID: | WBGene00019340 |
Length: | 112 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 33/74 - (44%) |
Gaps: | 13/74 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 TDRKHTKVEFPEARIYEETLQVLLYENRNAPDQELMQATSSARVGSASGTSINQYTSDEEEERTG 288
:||....:| |.:.|.::.|:.......::|: |.|:....:. |..||.||.::.
Worm 3 SDRPRLLIE------YGKILDLVEYQRLGFNVSDIME-----RYGNQLHIAF-QKNSDPEECKST 55
Fly 289 LARLRSNKR 297
| :.::|.|
Worm 56 L-QFKTNIR 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10465 | NP_610165.1 |
BTB |
20..117 |
CDD:197585 |
|
BTB_2 |
21..112 |
CDD:280393 |
|
K02F6.6 | NP_494290.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2716 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.