DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and K02F6.6

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494290.2 Gene:K02F6.6 / 186909 WormBaseID:WBGene00019340 Length:112 Species:Caenorhabditis elegans


Alignment Length:74 Identity:17/74 - (22%)
Similarity:33/74 - (44%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 TDRKHTKVEFPEARIYEETLQVLLYENRNAPDQELMQATSSARVGSASGTSINQYTSDEEEERTG 288
            :||....:|      |.:.|.::.|:.......::|:     |.|:....:. |..||.||.::.
 Worm     3 SDRPRLLIE------YGKILDLVEYQRLGFNVSDIME-----RYGNQLHIAF-QKNSDPEECKST 55

  Fly   289 LARLRSNKR 297
            | :.::|.|
 Worm    56 L-QFKTNIR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585
BTB_2 21..112 CDD:280393
K02F6.6NP_494290.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.