DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and K02F6.5

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001364769.1 Gene:K02F6.5 / 186908 WormBaseID:WBGene00019339 Length:232 Species:Caenorhabditis elegans


Alignment Length:225 Identity:60/225 - (26%)
Similarity:97/225 - (43%) Gaps:52/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKLNVGGHLYYTTIGTLTKNNDTMLSAMFSG---RMEVLTDSEGW---ILIDRCGNHFGIILNYL 79
            ::|:|||..:.|...||||         |.|   ::..|.|....   |:|||...||..:||::
 Worm     2 IRLDVGGRKFSTNRSTLTK---------FDGYFRKLPKLKDESSTTTRIVIDRSPKHFETVLNFM 57

  Fly    80 RDGTVPLPETNKEIAELLAEAKYYCITELAISCERAL-------YAHQEPK-PICRIPLITSQKE 136
            |||:|.|||:.|.:.:||.||.:|.:.:|...|::|:       .|.:||| |...:||::.   
 Worm    58 RDGSVDLPESLKHLRQLLREAIFYGLEKLIECCKQAMATSEIVAVAPEEPKSPDTVVPLLSD--- 119

  Fly   137 EQLLLSVSLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSL----RFNERILFIKDVIGP 197
                            .|..||...:......::|:.:...:.|||    .|::.:.::|.|...
 Worm   120 ----------------YQVNNNDLQHMVRICGDILRKLGNHNILSLPSVYTFDDYVNYLKSVTSA 168

  Fly   198 ------SEICCWSFYGHGKKVAEVCCTSIV 221
                  :.|..|..|......|..|...|:
 Worm   169 IIPAVYARISNWRHYFKKSDEAHSCVQKII 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 37/108 (34%)
BTB_2 21..112 CDD:280393 35/96 (36%)
K02F6.5NP_001364769.1 BTB_2 2..90 CDD:396684 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.