DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and F22E5.6

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494320.2 Gene:F22E5.6 / 184835 WormBaseID:WBGene00017705 Length:225 Species:Caenorhabditis elegans


Alignment Length:239 Identity:61/239 - (25%)
Similarity:103/239 - (43%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRD 81
            :.:.::||:||.::.|:..|||| .|.....:....:.:..|....|.|||...||..|||||||
 Worm     4 TDEKIRLNIGGTIFETSKSTLTK-FDGFFKTLLETDIPIQKDDSNCIFIDRSPRHFEKILNYLRD 67

  Fly    82 GTVP--LPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICRIPLITSQKEEQLLLSVS 144
            |...  |||:.||:.|:|.||::|.:..|...|:|:         .|:|....|......|::.:
 Worm    68 GADVDLLPESEKEVREILKEAQFYLLEGLMELCKRS---------SCKIRTFESYHHLLKLIAEA 123

  Fly   145 LKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIKDV------IGPSEICCW 203
            .||.:::....::|:..:..       .|.|..|.|.....:..::.|:.      ..||:    
 Worm   124 GKPVLVMFYLVKDNRIVHVP-------NNFEFLDFLEKHQGKLDIYFKESPYETTHQNPSQ---- 177

  Fly   204 SFYGHGKKVAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLL 247
             |...|::.|....|...|.|.:...:.........||.::.:|
 Worm   178 -FLPPGREEAAPSWTYCFYNTPKLPFRFTISFVEKLEEDIEFVL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 38/98 (39%)
BTB_2 21..112 CDD:280393 36/92 (39%)
F22E5.6NP_494320.2 BTB_2 8..100 CDD:366986 36/92 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3463
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.