DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and C40A11.2

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494198.3 Gene:C40A11.2 / 183352 WormBaseID:WBGene00016545 Length:213 Species:Caenorhabditis elegans


Alignment Length:175 Identity:50/175 - (28%)
Similarity:79/175 - (45%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRDG-TV 84
            :||::||.::.|....||| .|.....|.:..:.|..|..|.|.:||...:|.:||.||::| .|
 Worm     8 IKLDIGGTVFETCKLKLTK-FDGFFKTMLTSDIPVSIDESGCIFVDRSPKNFSLILKYLKEGDDV 71

  Fly    85 PLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICRIPLITSQKEEQLLLSVSLKPAV 149
            .||:..:|:.|:..||::|.:..|...|:..|....           ....||.|.:..:.|...
 Worm    72 ELPKFERELQEVRREAEFYLLDGLVDLCDSFLKIRS-----------YETSEELLHIIANCKKTA 125

  Fly   150 ILVVQRQNNKYSYTSTSDDNLLKNIELFD--------KLSLRFNE 186
            |||:       ||| ..:|:|..:.|.|:        ||.:.|.:
 Worm   126 ILVI-------SYT-VHNDHLWNSPESFNFQYVLENPKLDVYFKQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 32/96 (33%)
BTB_2 21..112 CDD:280393 31/91 (34%)
C40A11.2NP_494198.3 BTB_POZ 8..107 CDD:365784 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.