DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and C40A11.6

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494197.1 Gene:C40A11.6 / 173572 WormBaseID:WBGene00016549 Length:218 Species:Caenorhabditis elegans


Alignment Length:210 Identity:59/210 - (28%)
Similarity:91/210 - (43%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRD 81
            |...:||||||.::.|...|||| .|.....:....:.|..|:.....|||...:|..:|||:|.
 Worm     4 SETIVKLNVGGSVFETWKSTLTK-QDGFFKTLIETNVPVKKDTSDCYFIDRSPKYFETVLNYMRS 67

  Fly    82 GTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPI-CRIPLITSQKEEQLLLSVSL 145
            |...||::.||:.||..||::|.:..|...||          || .:|....|..|...:::.:.
 Worm    68 GVTVLPDSEKELQELKKEAEFYLLEHLVDLCE----------PIKNKIRTYGSSHELLQIIASTN 122

  Fly   146 KPAVILVVQRQNNKYSYTSTS---DDNLLKNIELFDKLSLRFNER-----ILFIKDVIGPSEICC 202
            ||.|::.....||...:....   .:.:.||.|..:......|:|     .|..|.::.|..:  
 Worm   123 KPVVVINYLIHNNDIIFVPKEFQFSEFIEKNREYLEIYFQPMNKREPWPIDLTNKLILTPEPL-- 185

  Fly   203 WSFYGHGKKVAEVCC 217
            |||..:  .:...||
 Worm   186 WSFRIY--NITHPCC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 35/96 (36%)
BTB_2 21..112 CDD:280393 33/90 (37%)
C40A11.6NP_494197.1 BTB_2 8..98 CDD:366986 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.