DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and C40A11.4

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494195.3 Gene:C40A11.4 / 173571 WormBaseID:WBGene00016547 Length:228 Species:Caenorhabditis elegans


Alignment Length:237 Identity:66/237 - (27%)
Similarity:95/237 - (40%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYLRDG 82
            |..:|||:||..:.|:..||:..|     .:|...:|..|.:.......|...||.:||||:|||
 Worm     4 SSTVKLNIGGEAFKTSRTTLSHFN-----GLFKTMLEKDTATTELSFPHRSPKHFDLILNYMRDG 63

  Fly    83 TVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKPICRIPLITSQKEEQLLLSVSLKP 147
            .|.||..|||:||:..||::|.:.|||..|:..........|...:..|...|::          
 Worm    64 DVLLPRNNKELAEVREEAEFYQLNELARQCDSIWIVQYNKGPREMLRRIAGSKKD---------- 118

  Fly   148 AVILVVQRQNNKYSYTSTSDDNLLKNIELF----------DKLSLRF-----NERILFIKDVIGP 197
              ||||        :.||..|.|:...|.|          ||:.:.|     :.||         
 Worm   119 --ILVV--------WYSTHKDELINCPEDFSFPYFYEQYSDKIDVYFQKVETSNRI--------- 164

  Fly   198 SEICCWSFYGHGKKVAEVCCTSIVYATDRKHTKVEFPEARIY 239
            ..:.|.|.:..|:|..:.|           | .||.|..|.:
 Worm   165 ENVPCDSCWCPGRKCDDKC-----------H-NVEAPSWRFW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 37/96 (39%)
BTB_2 21..112 CDD:280393 36/90 (40%)
C40A11.4NP_494195.3 BTB 7..90 CDD:383002 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D535763at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.