DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and KCTD7

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_694578.1 Gene:KCTD7 / 154881 HGNCID:21957 Length:289 Species:Homo sapiens


Alignment Length:97 Identity:43/97 - (44%)
Similarity:57/97 - (58%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLKGHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIIL 76
            ||.....:.:.||:||..:.|.:.||....||||:||||||..:.|||||...|||.|.|||.:|
Human    44 LLPQEFPEVVPLNIGGAHFTTRLSTLRCYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVL 108

  Fly    77 NYLRDGTVPLPETNKEIAELLAEAKYYCITEL 108
            |:||.|.:|   ..:.:..:..||:||.|..|
Human   109 NFLRSGDLP---PRERVRAVYKEAQYYAIGPL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 41/88 (47%)
KCTD7NP_694578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
BTB_POZ_KCTD7 48..139 CDD:349675 41/93 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.