DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and kctd1

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_012820753.2 Gene:kctd1 / 100486970 XenbaseID:XB-GENE-6076050 Length:840 Species:Xenopus tropicalis


Alignment Length:31 Identity:9/31 - (29%)
Similarity:13/31 - (41%) Gaps:6/31 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 PGT-GVAPFRSLFGHR-----SLFSAHFPGI 485
            ||. .|..||:....|     .:.:.|.||:
 Frog     8 PGVLKVEGFRATMAQRLVRVLQICAGHVPGV 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678
kctd1XP_012820753.2 DUF3504 270..432 CDD:463430
BTB_POZ_KCTD1 611..715 CDD:349695
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.