DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxc and CG31690

DIOPT Version :9

Sequence 1:NP_523620.1 Gene:sxc / 35486 FlyBaseID:FBgn0261403 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster


Alignment Length:468 Identity:125/468 - (26%)
Similarity:198/468 - (42%) Gaps:69/468 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PNSTGSNLVVKQNDIQSLSSVGLLELAHREYQAVDYESAEKHCM-------QLWRQDSTN----- 83
            |....|||         |..||.: :|.|    |.|..:..:|:       .||::.:::     
  Fly   428 PFLPASNL---------LFYVGFV-MAER----VLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRL 478

  Fly    84 ---TGVLLLLSSIH----FQCRRLD--KSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALD 139
               .|:.||| .:|    |: |.||  ...|....||..||  .:|..|||:|...:|:.:||..
  Fly   479 MLLCGLALLL-GVHGVRTFR-RNLDWRDEEQLFRSAISINP--PKALGNLGSVLSAQGRYEEAEL 539

  Fly   140 NYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEE 204
            ..|..:..:|...|.:.||........:..||:..:..|::..|.|.....:||..|.:||...:
  Fly   540 TLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQ 604

  Fly   205 AKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EAR 268
            .....|:......|..|         ..:|.      |.|...|       .|:.|..:.: :.|
  Fly   605 EAISVLRTGARLEGSGV---------RDRGA------HVEARYT-------CYLQLSVLYRSDGR 647

  Fly   269 IFDRAVA--AYLRALNLSP--NNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLA 329
            :.|.|.|  ..|:||.|.|  ..||:|..|..:..|....:.|....|.|::|||....||....
  Fly   648 LQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYG 712

  Fly   330 NALKEKG-QVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAH 393
            ..|...| ::.|||..:..||:|......|.::.|:...:|....||..|.|:|..:.|......
  Fly   713 QTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQ 777

  Fly   394 SNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFA 458
            |.:|..|:...:|.||.:.|::|:.:||..|.|::|:|..|:.......|:.||.:|:::.|..|
  Fly   778 SCVADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHA 842

  Fly   459 DAHSNLA--SIHK 469
            .:.:|||  ::||
  Fly   843 ISRANLARMNVHK 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxcNP_523620.1 TPR repeat 53..78 CDD:276809 6/31 (19%)
TPR_11 86..149 CDD:290150 22/68 (32%)
TPR repeat 86..112 CDD:276809 10/31 (32%)
TPR_11 118..183 CDD:290150 16/64 (25%)
TPR_1 118..151 CDD:278916 10/32 (31%)
TPR repeat 118..146 CDD:276809 9/27 (33%)
TPR repeat 151..181 CDD:276809 6/29 (21%)
TPR_12 182..252 CDD:290160 14/69 (20%)
TPR_1 192..219 CDD:278916 6/26 (23%)
TPR_1 220..253 CDD:278916 5/32 (16%)
TPR repeat 220..248 CDD:276809 4/27 (15%)
TPR 233..490 CDD:223533 71/245 (29%)
TPR_1 255..287 CDD:278916 11/36 (31%)
TPR repeat 255..282 CDD:276809 8/29 (28%)
TPR repeat 287..317 CDD:276809 8/29 (28%)
TPR_1 288..321 CDD:278916 11/32 (34%)
TPR_17 310..342 CDD:290167 10/32 (31%)
TPR repeat 322..350 CDD:276809 8/28 (29%)
TPR repeat 355..385 CDD:276809 8/29 (28%)
TPR_10 356..>385 CDD:290111 8/28 (29%)
TPR_1 390..423 CDD:278916 10/32 (31%)
TPR repeat 390..418 CDD:276809 8/27 (30%)
TPR repeat 423..453 CDD:276809 9/29 (31%)
TPR_1 424..455 CDD:278916 9/30 (30%)
TPR_1 458..491 CDD:278916 6/14 (43%)
TPR repeat 458..486 CDD:276809 6/14 (43%)
Glyco_transf_41 584..1044 CDD:290556
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 16/64 (25%)
TPR repeat 518..546 CDD:276809 9/27 (33%)
TPR repeat 551..581 CDD:276809 6/29 (21%)
TPR_1 552..584 CDD:278916 6/31 (19%)
TPR 565..841 CDD:223533 78/297 (26%)
TPR repeat 586..611 CDD:276809 5/24 (21%)
TPR repeat 634..660 CDD:276809 6/25 (24%)
TPR repeat 671..699 CDD:276809 8/27 (30%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809 8/27 (30%)
TPR repeat 773..803 CDD:276809 8/29 (28%)
TPR 808..841 CDD:197478 10/32 (31%)
TPR repeat 808..836 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.