DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxc and Tmtc1

DIOPT Version :10

Sequence 1:NP_523620.1 Gene:sxc / 35486 FlyBaseID:FBgn0261403 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster


Alignment Length:468 Identity:125/468 - (26%)
Similarity:198/468 - (42%) Gaps:69/468 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PNSTGSNLVVKQNDIQSLSSVGLLELAHREYQAVDYESAEKHCM-------QLWRQDSTN----- 83
            |....|||         |..||.: :|.|    |.|..:..:|:       .||::.:::     
  Fly   428 PFLPASNL---------LFYVGFV-MAER----VLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRL 478

  Fly    84 ---TGVLLLLSSIH----FQCRRLD--KSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALD 139
               .|:.||| .:|    |: |.||  ...|....||..||  .:|..|||:|...:|:.:||..
  Fly   479 MLLCGLALLL-GVHGVRTFR-RNLDWRDEEQLFRSAISINP--PKALGNLGSVLSAQGRYEEAEL 539

  Fly   140 NYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEE 204
            ..|..:..:|...|.:.||........:..||:..:..|::..|.|.....:||..|.:||...:
  Fly   540 TLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQ 604

  Fly   205 AKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EAR 268
            .....|:......|..|         ..:|.      |.|...|       .|:.|..:.: :.|
  Fly   605 EAISVLRTGARLEGSGV---------RDRGA------HVEARYT-------CYLQLSVLYRSDGR 647

  Fly   269 IFDRAVA--AYLRALNLSP--NNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLA 329
            :.|.|.|  ..|:||.|.|  ..||:|..|..:..|....:.|....|.|::|||....||....
  Fly   648 LQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYG 712

  Fly   330 NALKEKG-QVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAH 393
            ..|...| ::.|||..:..||:|......|.::.|:...:|....||..|.|:|..:.|......
  Fly   713 QTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQ 777

  Fly   394 SNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFA 458
            |.:|..|:...:|.||.:.|::|:.:||..|.|::|:|..|:.......|:.||.:|:::.|..|
  Fly   778 SCVADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHA 842

  Fly   459 DAHSNLA--SIHK 469
            .:.:|||  ::||
  Fly   843 ISRANLARMNVHK 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxcNP_523620.1 TPR repeat 53..78 CDD:276809 6/31 (19%)
TPR 80..318 CDD:440225 63/256 (25%)
TPR repeat 86..112 CDD:276809 10/31 (32%)
TPR repeat 118..146 CDD:276809 9/27 (33%)
TPR repeat 151..181 CDD:276809 6/29 (21%)
LapB 219..486 CDD:442196 72/259 (28%)
TPR repeat 220..248 CDD:276809 4/27 (15%)
TPR repeat 255..282 CDD:276809 8/29 (28%)
TPR repeat 287..317 CDD:276809 8/29 (28%)
TPR repeat 322..350 CDD:276809 8/28 (29%)
TPR repeat 355..385 CDD:276809 8/29 (28%)
TPR repeat 390..418 CDD:276809 8/27 (30%)
TPR repeat 423..453 CDD:276809 9/29 (31%)
TPR repeat 458..486 CDD:276809 6/14 (43%)
Glyco_transf_41 505..1036 CDD:404688
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 23/85 (27%)
TPR repeat 518..546 CDD:276809 9/27 (33%)
TPR repeat 551..581 CDD:276809 6/29 (21%)
LapB 556..838 CDD:442196 79/303 (26%)
TPR repeat 586..611 CDD:276809 5/24 (21%)
TPR repeat 634..660 CDD:276809 6/25 (24%)
TPR repeat 671..699 CDD:276809 8/27 (30%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809 8/27 (30%)
TPR repeat 773..803 CDD:276809 8/29 (28%)
TPR repeat 808..836 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.