DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxc and CG4341

DIOPT Version :9

Sequence 1:NP_523620.1 Gene:sxc / 35486 FlyBaseID:FBgn0261403 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster


Alignment Length:492 Identity:127/492 - (25%)
Similarity:192/492 - (39%) Gaps:98/492 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PNSTGSNLV-----VKQNDIQSLSSVGLLELAHREYQAVDY-ESAEKHCMQLWRQDSTNTGVLLL 89
            |....|||:     |....:..|.|||...|       |.| .|....|.|..|      .:|||
  Fly   515 PFLPASNLLFYVGFVVAERLLYLPSVGFCLL-------VGYGVSKLMSCNQRTR------NILLL 566

  Fly    90 LSSI---HFQCRRLDKSAQF--------STLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRR 143
            ..|:   ....|.|.::|.:        |.:||  ||  .:|..|||:|...:|:.:||....:.
  Fly   567 SFSLLLAAMSLRTLRRNADWRDEESLYRSAIAI--NP--PKALGNLGSVLSSQGRYEEAKQVLQE 627

  Fly   144 AVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKAC 208
            |:|.:|:..|.:.||.                  .|..|..:|                ..|..|
  Fly   628 AIRFRPNMADVHFNLG------------------ILHQNQQVY----------------PAAVEC 658

  Fly   209 YLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA 273
            :.:||:..|..|||:.|||..|.|.|:...||...:....||          |..:::....|:|
  Fly   659 FQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLD----------GAAVRDRTAHDQA 713

  Fly   274 -VAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPD----AYCNLANALK 333
             .:|||:              |..:|.|||.:..|:..||.|:...|..|.    .|..:.:.|.
  Fly   714 RSSAYLQ--------------LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLG 764

  Fly   334 EKGQVKEAEDCYNTALRLCSNH-ADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLA 397
            ...|..|||..:..||.|..|. |..|:....:.|......||...:.:||::.|:.|:.:.:.|
  Fly   765 RLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYA 829

  Fly   398 SVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHS 462
            ..|..|.:..|:.::::.|..:.|............::.|.....|...|.:|:.:.|..|.||:
  Fly   830 EFLSLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHT 894

  Fly   463 NLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLA 499
            ||.:|....|....|..||:.||:|:|.......|||
  Fly   895 NLGAILHLLGRTNHAAASYKAALRLQPGDAITLGNLA 931

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxcNP_523620.1 TPR repeat 53..78 CDD:276809 6/25 (24%)
TPR_11 86..149 CDD:290150 22/73 (30%)
TPR repeat 86..112 CDD:276809 9/36 (25%)
TPR_11 118..183 CDD:290150 15/64 (23%)
TPR_1 118..151 CDD:278916 11/32 (34%)
TPR repeat 118..146 CDD:276809 9/27 (33%)
TPR repeat 151..181 CDD:276809 4/29 (14%)
TPR_12 182..252 CDD:290160 20/69 (29%)
TPR_1 192..219 CDD:278916 5/26 (19%)
TPR_1 220..253 CDD:278916 13/32 (41%)
TPR repeat 220..248 CDD:276809 11/27 (41%)
TPR 233..490 CDD:223533 65/262 (25%)
TPR_1 255..287 CDD:278916 6/32 (19%)
TPR repeat 255..282 CDD:276809 6/27 (22%)
TPR repeat 287..317 CDD:276809 9/29 (31%)
TPR_1 288..321 CDD:278916 10/32 (31%)
TPR_17 310..342 CDD:290167 9/35 (26%)
TPR repeat 322..350 CDD:276809 8/31 (26%)
TPR repeat 355..385 CDD:276809 7/30 (23%)
TPR_10 356..>385 CDD:290111 7/28 (25%)
TPR_1 390..423 CDD:278916 7/32 (22%)
TPR repeat 390..418 CDD:276809 6/27 (22%)
TPR repeat 423..453 CDD:276809 4/29 (14%)
TPR_1 424..455 CDD:278916 4/30 (13%)
TPR_1 458..491 CDD:278916 14/32 (44%)
TPR repeat 458..486 CDD:276809 11/27 (41%)
Glyco_transf_41 584..1044 CDD:290556
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 21/98 (21%)
TPR_1 602..634 CDD:278916 10/31 (32%)
TPR repeat 602..630 CDD:276809 9/27 (33%)
TPR repeat 635..665 CDD:276809 10/63 (16%)
TPR_11 636..700 CDD:290150 22/97 (23%)
TPR_1 636..668 CDD:278916 10/65 (15%)
TPR repeat 670..694 CDD:276809 11/23 (48%)
TPR_11 714..784 CDD:290150 23/83 (28%)
TPR repeat 715..743 CDD:276809 12/41 (29%)
TPR repeat 748..782 CDD:276809 9/33 (27%)
TPR_11 755..819 CDD:290150 17/63 (27%)
TPR repeat 787..816 CDD:276809 6/28 (21%)
TPR_11 821..887 CDD:290150 11/65 (17%)
TPR repeat 822..850 CDD:276809 6/27 (22%)
TPR repeat 855..885 CDD:276809 4/29 (14%)
TPR_11 <874..921 CDD:290150 17/46 (37%)
TPR repeat 890..918 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.