DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxc and BBS8

DIOPT Version :9

Sequence 1:NP_523620.1 Gene:sxc / 35486 FlyBaseID:FBgn0261403 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_608524.1 Gene:BBS8 / 33217 FlyBaseID:FBgn0031255 Length:549 Species:Drosophila melanogaster


Alignment Length:537 Identity:108/537 - (20%)
Similarity:178/537 - (33%) Gaps:147/537 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HVEQTRINMQSQGQSHQLPSAAHILLDQN-------PN----------STGSNLVVKQNDIQSLS 49
            ||:......:.:.:.||...|.|.....|       |.          .:|.::::....::.:.
  Fly    43 HVQLFTTKEEEEEEQHQQQQAEHSRFGSNLQRIGPRPRGAAGGGAGAVDSGPSIMMPTWLMEGVW 107

  Fly    50 SVGLLELAHREY--------------QAVDYE---------SAEKHCMQ--------LWRQDSTN 83
            .:.:..|..|.|              :.|::|         |:.|...|        ..:..|..
  Fly   108 QLKMRALTQRVYVDDLDEDDGGNEATEEVEFERIATAARPGSSIKTAFQPRPLTSQRAQQARSRG 172

  Fly    84 TGVLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLK 148
            .||      .|....||:.|...|....:....|:...|:||:             ....|.|::
  Fly   173 AGV------AHSSDGRLNSSRPGSAAVARPGTSLSRPGSSLGS-------------RCGTASRIR 218

  Fly   149 PDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGR-LEEAKACYLKA 212
                       |...||.::..|......|.:.||.:|..|.   .|:|||.: |...:|...||
  Fly   219 -----------ATSAAAFNVGDATSKLYQASRLNPTIYAERE---TLVKALFQFLYYHEADVQKA 269

  Fly   213 IETC----------PGFAVAWSNLGCVFN-----AQGEIWLAIHH-------FEKAVTLDPNFLD 255
            ...|          |.     .:.||..:     ..|...||:|:       .::::|..|: .|
  Fly   270 HSLCQAVLEVERQKPS-----GSTGCTLSWWWQQQMGRCLLALHYPRRAEPFLQQSLTSFPH-PD 328

  Fly   256 AYINLGNV----------------------------LKEARIF------DRAVAAYLRALNLSPN 286
            .|:.|..|                            |::|||.      :.|:..|..|..|.|.
  Fly   329 TYLLLSRVYQRIKQPERALLVIGEVVDSRPFDVTYRLEQARIHQAMEQQEDALQLYRLAAKLHPI 393

  Fly   287 NAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRL 351
            |.....::|..|:.....::|:..|||.:.|....|:.|||:|......||:.....|:..||..
  Fly   394 NVESLASIAVGYFYDNNPEMALMYYRRILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALAT 458

  Fly   352 CS---NHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHY 413
            .:   ..:|...||:.:....|....|.|.....|.......||.:|||.:..|.|.:..|..:.
  Fly   459 ATQPGQKSDIWYNLSFVAVTSGDFNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYL 523

  Fly   414 KEAIRIQPTFADAYSNM 430
            ..|..:.|..|:..:|:
  Fly   524 NAAKDVMPDAAEVTTNL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxcNP_523620.1 TPR repeat 53..78 CDD:276809 8/55 (15%)
TPR_11 86..149 CDD:290150 12/62 (19%)
TPR repeat 86..112 CDD:276809 6/25 (24%)
TPR_11 118..183 CDD:290150 10/64 (16%)
TPR_1 118..151 CDD:278916 5/32 (16%)
TPR repeat 118..146 CDD:276809 4/27 (15%)
TPR repeat 151..181 CDD:276809 5/29 (17%)
TPR_12 182..252 CDD:290160 21/92 (23%)
TPR_1 192..219 CDD:278916 10/37 (27%)
TPR_1 220..253 CDD:278916 8/44 (18%)
TPR repeat 220..248 CDD:276809 6/39 (15%)
TPR 233..490 CDD:223533 56/242 (23%)
TPR_1 255..287 CDD:278916 13/65 (20%)
TPR repeat 255..282 CDD:276809 11/60 (18%)
TPR repeat 287..317 CDD:276809 7/29 (24%)
TPR_1 288..321 CDD:278916 7/32 (22%)
TPR_17 310..342 CDD:290167 11/31 (35%)
TPR repeat 322..350 CDD:276809 9/27 (33%)
TPR repeat 355..385 CDD:276809 7/29 (24%)
TPR_10 356..>385 CDD:290111 7/28 (25%)
TPR_1 390..423 CDD:278916 10/32 (31%)
TPR repeat 390..418 CDD:276809 9/27 (33%)
TPR repeat 423..453 CDD:276809 2/8 (25%)
TPR_1 424..455 CDD:278916 2/7 (29%)
TPR_1 458..491 CDD:278916
TPR repeat 458..486 CDD:276809
Glyco_transf_41 584..1044 CDD:290556
BBS8NP_608524.1 TPR repeat 299..322 CDD:276809 4/22 (18%)
TPR repeat 327..355 CDD:276809 4/27 (15%)
TPR_16 331..392 CDD:290168 10/60 (17%)
TPR repeat 365..389 CDD:276809 7/23 (30%)
Coatomer_WDAD <378..519 CDD:281977 37/140 (26%)
TPR_11 394..457 CDD:290150 17/62 (27%)
TPR repeat 394..424 CDD:276809 7/29 (24%)
TPR repeat 429..457 CDD:276809 9/27 (33%)
TPR_11 465..526 CDD:290150 15/60 (25%)
TPR repeat 466..493 CDD:276809 6/26 (23%)
TPR repeat 500..526 CDD:276809 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.