DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and DPF3

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001267473.1 Gene:DPF3 / 8110 HGNCID:17427 Length:412 Species:Homo sapiens


Alignment Length:419 Identity:111/419 - (26%)
Similarity:166/419 - (39%) Gaps:147/419 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KIQNF------LNDKEKYKEILENSENFNTRLCIERRLRMPFLDPQTGVAQTHCSLFMKKKQRMP 78
            |::|.      |.| :.|||.:|:..::|:|||.||.:|:||||.||||||.:|.::|:|:.|.|
Human    56 KLENLFHMCTRLGD-QFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGP 119

  Fly    79 GLRHGQIYTYPSSRWRKPKRQYLLNP--NQSFRAYQYREHNLQHSHHQTHQHHHHIPSSGVAVPQ 141
            ||..||:||||:..|||.:|   |:|  :...|..:.:                  |...:.:.:
Human   120 GLAPGQLYTYPARCWRKKRR---LHPPEDPKLRLLEIK------------------PEVELPLKK 163

  Fly   142 NPHLAESAAI-AATDGNSMGASGDNDSKDSHANVEKEWFHDEMDTSHFHHGDEFEDDFDSDNDFD 205
            :...:||..: |...|..:....|...::|...:::...:||    :...|:| |:|.:.|..  
Human   164 DGFTSESTTLEALLRGEGVEKKVDAREEESIQEIQRVLENDE----NVEEGNE-EEDLEEDIP-- 221

  Fly   206 ESYTSRGKRKKCSRPRRTNANVEGTPKRGRKGGGNRRKNAVEGESDR-----------KRRAGGN 259
                   |||..:|.|          .||..||..|...|.:.:.|:           |.|.|  
Human   222 -------KRKNRTRGR----------ARGSAGGRRRHDAASQEDHDKPYVCDICGKRYKNRPG-- 267

  Fly   260 SANTSAAAAAAAAAVAHAACTAAAVASTGLYASHSNSASPIPINDDNSQSGLILPTNISSSYDKT 324
                                       ...:.:|::.||.   ..|.:|.            .:|
Human   268 ---------------------------LSYHYAHTHLASE---EGDEAQD------------QET 290

  Fly   325 SSDAGASNDSIPLATMVAINAGLTTSNVCNAHPVQTGTNQTVFATGNKVKQRVERDIAQPSPYCD 389
            .|.....|::                     |..|.|.:.||.                |:.|||
Human   291 RSPPNHRNEN---------------------HRPQKGPDGTVI----------------PNNYCD 318

  Fly   390 FCLGDQRENKKTNMPEELVSCSDCGRSGH 418
            ||||....|||:..|||||||:|||||.|
Human   319 FCLGGSNMNKKSGRPEELVSCADCGRSAH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758 37/67 (55%)
PHD1_d4 387..442 CDD:277091 23/32 (72%)
PHD2_d4 444..489 CDD:277005
DPF3NP_001267473.1 Requiem_N 68..139 CDD:290758 38/71 (54%)
PHD_SF 316..>347 CDD:304600 22/30 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156494
Domainoid 1 1.000 97 1.000 Domainoid score I7254
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2840
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49768
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 1 1.000 - - otm40575
orthoMCL 1 0.900 - - OOG6_105541
Panther 1 1.100 - - LDO PTHR10615
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5121
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.030

Return to query results.
Submit another query.