DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and Kat6b

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_006519326.1 Gene:Kat6b / 54169 MGIID:1858746 Length:2054 Species:Mus musculus


Alignment Length:109 Identity:60/109 - (55%)
Similarity:73/109 - (66%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 AQPSPYCDFCLGDQRENKKTNMPEELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCS 446
            |.|.|.|.||||.:..|:: ..||||:||:|||.|||||||:|...:..:||..||||||||.||
Mouse   211 ADPIPICSFCLGTKESNRE-KKPEELLSCADCGSSGHPSCLKFCPELTANVKALRWQCIECKTCS 274

  Fly   447 ICGT-SDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 489
            .|.. ..|.|.:||||.||||:||.|..|||...|:|.|.|::|
Mouse   275 ACRVQGKNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091 30/54 (56%)
PHD2_d4 444..489 CDD:277005 23/45 (51%)
Kat6bXP_006519326.1 H15 94..168 CDD:197772
PHD1_MOZ_MORF 213..270 CDD:277090 32/57 (56%)
PHD2_KAT6A_6B 272..318 CDD:277002 23/45 (51%)
PLN00104 <721..989 CDD:215056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.