DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and CG1894

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:194 Identity:39/194 - (20%)
Similarity:62/194 - (31%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HSHHQTHQHHHHIPSSGVAVPQNPHLAESAAIAATDGNSMGASGDNDSKDSHANVEKEWFHDEMD 184
            |..:|.......|.|....:|:...|..:...:||.|....||                 ..||.
  Fly    10 HLKYQPLGDQDGISSKLPDIPRALQLTNAKESSATRGLGQSAS-----------------KSEMG 57

  Fly   185 TSHFHHGDEFEDDFDSDNDFDESYTSRGKRKKCSRPRRTNANVEGTPKRGRKGGGN------RRK 243
            .|      :.::|.....:..|:.|..|   .|...:|..|    |||:..:|...      ...
  Fly    58 KS------QLQNDSSLQKNIQETKTITG---SCIEAQRIGA----TPKKQLEGVKEPNMISLLHT 109

  Fly   244 NAVEGESDRKRRAGGNSANTSAAAAAAAAAVAHAACTAAAVASTGLYASHSNSASPIPINDDNS 307
            ||.....||:|:...::..:........|.|  ...........|.|...:.|:||.|:.:|.:
  Fly   110 NASSNVDDRQRQETIDNEKSDVQKEKEDAKV--KVIRNIEKVQFGRYEIETTSSSPYPVINDKA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091
PHD2_d4 444..489 CDD:277005
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 9/44 (20%)
MOZ_SAS 202..378 CDD:280097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.