DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and e(y)3

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster


Alignment Length:286 Identity:78/286 - (27%)
Similarity:120/286 - (41%) Gaps:76/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DESYTSRGKRKKCSRPRRTNANVEGT-PKRGRKGGGNRRKNAVEGESDRKRRAGGNSANTSAAAA 268
            ||..||....|...:.:....:|..| |.|       |.:.:...::|:.|.|  :|::||:|.:
  Fly  1589 DEIKTSAPAPKDLGQEQSAIKSVTVTAPVR-------RSRRSTRQQTDKVRTA--SSSSTSSAQS 1644

  Fly   269 AAAAAVAHAACTAAAVASTGLYASHSNSASPIPINDDNSQSGLILPTNISSSYDKTSSDAGASND 333
            .::|                  :|.:.|:|.....|::..|.    |:..||....||.||:.::
  Fly  1645 VSSA------------------SSGNGSSSDTESGDESDFSS----TSSCSSSTGASSGAGSEDE 1687

  Fly   334 SIPLATMVAINAGLTTSNVCNAHPVQTGTNQTVFATGNKVKQRVERDIAQPSPYCDFCLGDQREN 398
            .               .|.|:: .|:..|                         |..||..|..|
  Fly  1688 D---------------GNECSS-SVRLST-------------------------CGVCLRSQHRN 1711

  Fly   399 KKTNMPEELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDC 463
            .: :|||..:.|..|.:..||||:.....|:..|:.|.|||..||.|..|.:|....::|:|:.|
  Fly  1712 AR-DMPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCIKCRSSQRPGKMLYCEQC 1775

  Fly   464 DRGYHMYCLSPPLVTPPEGSWSCKLC 489
            |||||:|||.  |.|.|:|.|||:.|
  Fly  1776 DRGYHIYCLG--LRTVPDGRWSCERC 1799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091 20/54 (37%)
PHD2_d4 444..489 CDD:277005 21/44 (48%)
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 21/79 (27%)
RanBP2-type Zn finger 1700..1725 CDD:275375 10/50 (20%)
RanBP2-type Zn finger 1749..1775 CDD:275375 10/25 (40%)
PHD2_PHF10 1756..1799 CDD:277004 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2732
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105037at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10615
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.