DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and tth

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster


Alignment Length:388 Identity:124/388 - (31%)
Similarity:175/388 - (45%) Gaps:102/388 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVNIANFEKIQNFLNDKEKYKEILENSENFNTRLCIERRLRMPFLDPQTGVAQTHCSLFMKKKQR 76
            :|::.|..||::||.| ..|:|.:|.|.|||||||.|||.|:|||||||||||.|..||:.|:||
  Fly     9 IVSMPNLAKIESFLKD-VSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQR 72

  Fly    77 MPGLRHGQIYTYPSSRWRKPKRQYLLN-----PNQSFRAYQYREHNLQHSHHQTHQHHHHIPSSG 136
            |||.|.|||||||::||||.:||||..     |.:.|:|.:              :.|..:.:||
  Fly    73 MPGFRQGQIYTYPAARWRKSRRQYLSKMYSRFPERPFQALR--------------KEHEALVASG 123

  Fly   137 V------------AVPQNPHLAESA------------------------------AIAATDGNSM 159
            |            ::|.:..||.|:                              |.:..:.:|:
  Fly   124 VNLGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSL 188

  Fly   160 GASG--DNDSKDSHAN----------------VEKEWFHDEMDTSHFHHGDEFEDDFDSDNDFDE 206
            ||:|  .:|||||...                :.||||:|:||.:.....:|.:...|.:.|:|.
  Fly   189 GAAGGDTSDSKDSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDP 253

  Fly   207 SYTSRGKRKKCSRPRRTNANVEGTPKRGRKGGGNRRKNAVEGESDRKRRAGGNSANTSAAAAAAA 271
            .|.::.:||:  ||          .|||...||........|        ||||..:|::...:|
  Fly   254 RYGNKKRRKR--RP----------GKRGGDSGGGGGGGGAGG--------GGNSGGSSSSRRRSA 298

  Fly   272 AAVAHAACTAAAVASTGLYASHSNSASPIPINDDNSQSGLILPTNISSSYDKTSSDAGASNDS 334
            ||.:....|.||: ...|.|..|..:.| ..|.....||.||..::.:.....|...|....|
  Fly   299 AARSRITTTDAAL-DASLEAIESGESVP-GSNGGPISSGGILSGSLGAGLAGVSGSGGGGGAS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758 47/67 (70%)
PHD1_d4 387..442 CDD:277091
PHD2_d4 444..489 CDD:277005
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 48/70 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443419
Domainoid 1 1.000 92 1.000 Domainoid score I7563
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105037at50557
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
65.850

Return to query results.
Submit another query.