DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and mof

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_511051.1 Gene:mof / 31518 FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster


Alignment Length:352 Identity:68/352 - (19%)
Similarity:109/352 - (30%) Gaps:110/352 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKYKEIL------ENSENFNTRLCIERRLRMPF----------LDPQ-------TGVAQTHCSLF 70
            :|.||::      |:..:.:|.:|:..  ..|:          :||.       |.|......|.
  Fly   169 QKQKEVVDQEIETEDEPSSDTVICVAD--INPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLH 231

  Fly    71 MKKKQRM-----------PGLRHGQIYTYPSS---RWRKPKRQYLLNPNQSFRAYQYREHNLQHS 121
            :|..|::           |.....|:...|:|   ...:|...| |:|....|..|.....|...
  Fly   232 LKGTQQLGLPLAAPPPPPPPPAAEQVPETPASPTDDGEEPPAVY-LSPYIRSRYMQESTPGLPTR 295

  Fly   122 HHQTHQHHHHIPSSGVAVPQNPHLAESAAIAATDGNSMGASGDNDSKDSHANVEKEWFHDEMDTS 186
            .........::|...|.:|....|:.:.. |.:|.:|..:|.|:|.::.         .||.|..
  Fly   296 LAPRDPRQRNMPPPAVVLPIQTVLSANVE-AISDDSSETSSSDDDEEEE---------EDEDDAL 350

  Fly   187 HFHH-----------GDEFEDDFDSDNDFDESYTSRGKRKKCSRPRRTNANVEGTPKRGR----- 235
            ...|           ||......|...:.|:.|..|.:              :||..||:     
  Fly   351 TMEHDNTSRETVITTGDPLMQKIDISENPDKIYFIRRE--------------DGTVHRGQVLQSR 401

  Fly   236 --------------KGGGNRRKNAVEGE---SDRKRRAGG-------------NSANTSAAAAAA 270
                          ..|.|||.:...|.   ||.....||             .|.:....|..|
  Fly   402 TTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQA 466

  Fly   271 AAAVAHAACTAAAVASTGLYASHSNSA 297
            |||.|.::......|:...|.|:..::
  Fly   467 AAAAAASSERQKRAANKDYYLSYCENS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758 19/104 (18%)
PHD1_d4 387..442 CDD:277091
PHD2_d4 444..489 CDD:277005
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 11/63 (17%)
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.