DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and Tip60

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster


Alignment Length:315 Identity:67/315 - (21%)
Similarity:101/315 - (32%) Gaps:129/315 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 THQHHHHIPSSGVAVPQNPHLAESAAIAATDGNSMGASGDNDSKDSHANVEKEWFHDEMDTSHFH 189
            |.|.||.:..| |:.|.:|....|.|:||......||||   |....|.:.              
  Fly    99 TPQRHHSLAGS-VSRPTSPQHPGSGALAAIPQTPTGASG---SVPPPAGIP-------------- 145

  Fly   190 HGDEFEDDFDSDNDFDESYTSRGKRKKCSRPRRTNANVEGTPKRGRK-GGGNRRKNAVEGESDRK 253
                                             .:....|||..|.: ..||....|::...:||
  Fly   146 ---------------------------------NSVAPPGTPSSGGELVNGNNLAAALQKRINRK 177

  Fly   254 RRAGGNSANTSAAAAAAAAAVAHAACTAAAVASTGLYASHSN-------SASPIPINDDNSQSGL 311
            |:..|.||:            .|.:.|:..      ..||.:       :|:|:.:..|    ||
  Fly   178 RKNHGGSAH------------GHHSLTSQQ------QQSHPHPTTPQTPTATPVHVTGD----GL 220

  Fly   312 ILPTNISSSYDKTSSDAGASNDSIPLATMVAINAGLTTSNVCNAHPVQTG---TNQTVFATGNKV 373
            |               :||:||.           |..:.:.....|.|:|   |:|....|..|.
  Fly   221 I---------------SGAANDD-----------GDGSQDGKTPTPRQSGSMVTHQDDVVTRMKN 259

  Fly   374 KQRVE--RDIAQP---SPY------------CDFCLGDQRENKKTNMPEELVSCS 411
            .:.:|  |...:|   |||            |:||| ..|:::|. :...|..|:
  Fly   260 VEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCL-KYRKSRKC-LERHLSKCN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091 9/37 (24%)
PHD2_d4 444..489 CDD:277005
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553
Drf_FH1 84..>157 CDD:283903 21/108 (19%)
PHA01732 139..>196 CDD:222828 16/121 (13%)
NAT_SF 254..533 CDD:302625 16/61 (26%)
MOZ_SAS 316..500 CDD:280097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.