DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and Rsf1

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_218939.4 Gene:Rsf1 / 308839 RGDID:1311245 Length:1448 Species:Rattus norvegicus


Alignment Length:361 Identity:72/361 - (19%)
Similarity:113/361 - (31%) Gaps:133/361 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 KRKKCSRPRRTNANVEGTPKRGRKGGGNRRKNA------VEGESDRKRRAGGNSANTSAA--AAA 269
            |.|:.|..:..:....|:.:      |...:||      ...||.|...|..::|.||..  .:.
  Rat   642 KEKQTSEKKGVDCLSRGSSE------GQSLENASPDILRENSESSRVEMAKLDNAQTSGVEDTSQ 700

  Fly   270 AAAAVAHAACTAAAVASTGLYASHSNSASPIPINDDNSQSGLILPTNISSSYDKTSS-----DAG 329
            ...:|....|....|:.     .:|.::....|..:..:.|:.|...|||...|...     |:.
  Rat   701 TKGSVQKNKCKYKLVSE-----GNSTASENTEITSERKKEGIKLTIRISSRKKKPDCPPQIVDSE 760

  Fly   330 ASNDSIPLATMVAINAGLTTSNVCNAHPVQTGTNQTVFATGNKVKQ--RVERDIAQPSPYCDFCL 392
            :..:                         :.|..:...:.|..:::  |:.|..|:.:.     :
  Rat   761 SKEE-------------------------KAGKEEEKTSVGRTLRRSPRISRPTAKVAE-----I 795

  Fly   393 GDQRENKKTNMPEELVSCSDCGRSGHPSCLQF-------------TANMIISVK----------- 433
            .||:.:||....||       |..|..:.||.             |.:....||           
  Rat   796 RDQKADKKRAEGEE-------GVEGETTSLQTADKKEHLKKAEKDTNSKASKVKPKGKVRWTGSR 853

  Fly   434 -RYRWQCIECKY-------------------------------------CSICGTSDNDDQLLFC 460
             |.||     ||                                     |..||..::.:.:|.|
  Rat   854 TRGRW-----KYSSNDESEGSESDKSSAASEEEEGKESEEAVLPDDDEPCKKCGLPNHPELILLC 913

  Fly   461 DDCDRGYHMYCLSPPLVTPPEGSWSCKLCMEEFHKI 496
            |.||.|||..||.|||:..|:|.|.|..|.   ||:
  Rat   914 DSCDSGYHTACLRPPLMIIPDGEWFCPPCQ---HKL 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091 16/79 (20%)
PHD2_d4 444..489 CDD:277005 21/81 (26%)
Rsf1XP_218939.4 WHIM1 102..152 CDD:292246
WHIM2 154..186 CDD:292247
PHD_RSF1 897..942 CDD:277018 20/44 (45%)
BAH 919..>972 CDD:295389 15/31 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.