DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and KAT6B

DIOPT Version :10

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_036462.2 Gene:KAT6B / 23522 HGNCID:17582 Length:2073 Species:Homo sapiens


Alignment Length:109 Identity:60/109 - (55%)
Similarity:73/109 - (66%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 AQPSPYCDFCLGDQRENKKTNMPEELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCS 446
            |.|.|.|.||||.:..|:: ..||||:||:|||.|||||||:|...:..:||..||||||||.||
Human   210 ADPIPICSFCLGTKESNRE-KKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQCIECKTCS 273

  Fly   447 ICGTSD-NDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 489
            .|.... |.|.:||||.||||:||.|..|||...|:|.|.|::|
Human   274 ACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 DPF1-3_N 31..93 CDD:464074
PHD1_d4 387..442 CDD:277091 30/54 (56%)
PHD2_d4 444..489 CDD:277005 23/45 (51%)
KAT6BNP_036462.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..97
H15 113..167 CDD:197772
PHD1_MOZ_MORF 212..269 CDD:277090 32/57 (56%)
PHD2_KAT6A_6B 271..317 CDD:277002 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..409
Negatively regulates HAT activity 361..717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..663
Catalytic 718..1008
PLN00104 <721..989 CDD:215056
Interaction with BRPF1. /evidence=ECO:0000269|PubMed:18794358 752..1008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1022..1452
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1484..1538
Interaction with RUNX1 and RUNX2. /evidence=ECO:0000269|PubMed:11965546 1560..2073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1580..1619
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.