DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d4 and KAT6B

DIOPT Version :9

Sequence 1:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001357065.1 Gene:KAT6B / 23522 HGNCID:17582 Length:2073 Species:Homo sapiens


Alignment Length:109 Identity:60/109 - (55%)
Similarity:73/109 - (66%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 AQPSPYCDFCLGDQRENKKTNMPEELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCS 446
            |.|.|.|.||||.:..|:: ..||||:||:|||.|||||||:|...:..:||..||||||||.||
Human   210 ADPIPICSFCLGTKESNRE-KKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQCIECKTCS 273

  Fly   447 ICGTSD-NDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 489
            .|.... |.|.:||||.||||:||.|..|||...|:|.|.|::|
Human   274 ACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d4NP_610163.1 Requiem_N 30..98 CDD:290758
PHD1_d4 387..442 CDD:277091 30/54 (56%)
PHD2_d4 444..489 CDD:277005 23/45 (51%)
KAT6BNP_001357065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..97
H15 113..167 CDD:197772
PHD1_MOZ_MORF 212..269 CDD:277090 32/57 (56%)
PHD2_KAT6A_6B 271..317 CDD:277002 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..409
Negatively regulates HAT activity 361..717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..663
Catalytic 718..1008
PLN00104 <721..989 CDD:215056
Interaction with BRPF1. /evidence=ECO:0000269|PubMed:18794358 752..1008
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q92794 856..860
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q92794 865..871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1022..1452
BASP1 1435..>1564 CDD:310221
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1484..1538
Interaction with RUNX1 and RUNX2. /evidence=ECO:0000269|PubMed:11965546 1560..2073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1580..1619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.