DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Creb1

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_112279.1 Gene:Creb1 / 81646 RGDID:620218 Length:341 Species:Rattus norvegicus


Alignment Length:282 Identity:62/282 - (21%)
Similarity:109/282 - (38%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LSSPISGLKQIPSACSGEFKRNVNDNNFQLDLTNSRNDLPEPNSSPTRSLNRSNVNGCSNEEAVY 136
            :.||  .::.:.|:|. :.||..:..  |:.......|..|...|.|.|..|..:  .|...:..
  Rat    78 IQSP--QVQTVQSSCK-DLKRLFSGT--QISTIAESEDSQESVDSVTDSQKRREI--LSRRPSYR 135

  Fly   137 PLLVDSDKFDPFFEPAKVRSPNKEFNSTISNLSDIKNELPETSQ------------DLGFNSYNT 189
            .:|.|.....|.....:.....:|.::.......:...:.:||.            .|..|..:.
  Rat   136 KILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDG 200

  Fly   190 SRNNSTLTKSWPINTELNLDNQVPKTVLPLSRT-----IYLPSHDYKGLLPTVKCNGD-RTLKKN 248
            .:...|||.:....|      |...|:|..::|     |.:||:.    :.....:|| :|.:..
  Rat   201 VQGLQTLTMTNAAAT------QPGTTILQYAQTTDGQQILVPSNQ----VVVQAASGDVQTYQIR 255

  Fly   249 VNVRSKISNIVIKKKNATFIQSLKESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLE 313
            ....|.|:..|        :.:...:.|:...::...|:..|::||||:|...|:|:||||..||
  Rat   256 TAPTSTIAPGV--------VMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLE 312

  Fly   314 TRINKLEKECDSLKAENITLRD 335
            .|:..||.:..:|..|...|:|
  Rat   313 NRVAVLENQNKTLIEELKALKD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
Creb1NP_112279.1 pKID 113..151 CDD:396650 9/39 (23%)
bZIP_CREB1 285..339 CDD:269838 22/50 (44%)
coiled coil 286..337 CDD:269838 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.