DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and creb1a

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_957203.1 Gene:creb1a / 573207 ZFINID:ZDB-GENE-040426-750 Length:318 Species:Danio rerio


Alignment Length:303 Identity:66/303 - (21%)
Similarity:119/303 - (39%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SEFSLSSPISGLKQIPS-----------ACSGEFKRNVNDNNFQLDLTNSRNDLPEPNSSPTRSL 121
            ::.|.::|...|.|:|:           |......::......|:......:|..|...|.|.|.
Zfish    36 AQASATAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESDDSQESVDSVTDSQ 100

  Fly   122 NRSNVNGCSNEEAVYPLLVD--SDKFDPFFEPA--KVRSPNKEFNST--ISNLSDIKNELPETSQ 180
            .|..:  .|...:...:|.|  ||      .||  ::.....|.:||  |:.:: :...:.:||.
Zfish   101 KRREI--LSRRPSYRKILNDLSSD------APAVPRIEEEKSEEDSTPAITTVT-VPTPIYQTSS 156

  Fly   181 ------------DLGFNSYNTSRNNSTLTKSWPINTELNLDNQVP-KTVLPLSRT-----IYLPS 227
                        .|..|..:..:...|||.:       |.....| .|:|..::|     |.:||
Zfish   157 GQYIAITQGGAIQLANNGTDGVQGLQTLTMT-------NAAGAQPGTTILQYAQTSDGQQILVPS 214

  Fly   228 HDYKGLLPTVKCNGDRTLKKNVNVRSKISNIVIKKKNATFIQSLKESTPSHTMDDKIYKKYQRMI 292
            :.    :.....:||   .:...:|:..::.:.    ...:.:...:.||...::...|:..|::
Zfish   215 NQ----VVVQAASGD---VQAYQIRTAAASTIA----PGVVMASSPALPSQGAEEATRKREVRLM 268

  Fly   293 KNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            ||||:|...|:|:||||..||.|:..||.:..:|..|...|:|
Zfish   269 KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
creb1aNP_957203.1 pKID 91..131 CDD:280355 12/47 (26%)
bZIP_CREB1 262..316 CDD:269838 22/50 (44%)
coiled coil 263..315 CDD:269838 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.