powered by:
Protein Alignment Atf6 and crema
DIOPT Version :9
Sequence 1: | NP_995745.1 |
Gene: | Atf6 / 35480 |
FlyBaseID: | FBgn0033010 |
Length: | 741 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_683024.3 |
Gene: | crema / 555432 |
ZFINID: | ZDB-GENE-030131-7031 |
Length: | 300 |
Species: | Danio rerio |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 36/61 - (59%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 275 TPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
:|....::...|:..|::||||:|...|:|:||||..||.|:..||.:..:|..|...|:|
Zfish 233 SPQPNAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 293
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170577534 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.