DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and creb1b

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_005167757.1 Gene:creb1b / 550516 ZFINID:ZDB-GENE-050417-355 Length:324 Species:Danio rerio


Alignment Length:99 Identity:28/99 - (28%)
Similarity:49/99 - (49%) Gaps:19/99 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SNIVIKKKNATFIQSLK-ESTPSHTM------------------DDKIYKKYQRMIKNRESASLS 301
            ||.|:.:..:..:|:.: .:.|:.|:                  ::...|:..|::||||:|...
Zfish   219 SNQVVVQAASGDVQAYQIRTAPTSTIAPGVVMASSPALPSQGGAEEATRKREVRLMKNREAAREC 283

  Fly   302 RKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            |:|:||||..||.|:..||.:..:|..|...|:|
Zfish   284 RRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
creb1bXP_005167757.1 pKID 96..136 CDD:280355
bZIP_CREB1 268..322 CDD:269838 22/50 (44%)
coiled coil 269..321 CDD:269838 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.