DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and ATF1

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_016874820.1 Gene:ATF1 / 466 HGNCID:783 Length:279 Species:Homo sapiens


Alignment Length:167 Identity:44/167 - (26%)
Similarity:72/167 - (43%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PETSQDLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRT-----IYLPSHDYKGLLP 235
            |.|....|..:...:.:.||               |...|:|..::|     |.:||:.    :.
Human   131 PGTDGVQGLQTLTMTNSGST---------------QQGTTILQYAQTSDGQQILVPSNQ----VV 176

  Fly   236 TVKCNGDRTLKKNVNVRSKISNIVIKKKNATFIQSLKESTPSHT--MDDKIYKKYQRMIKNRESA 298
            ....:||   .:...:|:..|...:.:   |.:.:...:..|.|  .||...|:..|::||||:|
Human   177 VQTASGD---MQTYQIRTTPSATSLPQ---TVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAA 235

  Fly   299 SLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            ...|:|:||||..||.|:..||.:..:|..|..||:|
Human   236 RECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 22/49 (45%)
coiled coil 287..338 CDD:269848 22/49 (45%)
ATF1XP_016874820.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.