DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Atf1

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001094365.1 Gene:Atf1 / 315305 RGDID:1307360 Length:268 Species:Rattus norvegicus


Alignment Length:101 Identity:33/101 - (32%)
Similarity:50/101 - (49%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SNIVIKKKNATFIQSLK-ESTPSHT--------------------MDDKIYKKYQRMIKNRESAS 299
            ||.|:.:..:..:|:.: .:|||.|                    .||...|:..|::||||:|.
  Rat   161 SNQVVVQTASGDMQTYQIRTTPSATSLPQTMVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR 225

  Fly   300 LSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            ..|:|:||||..||.|:..||.:..:|..|..||:|
  Rat   226 ECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 22/49 (45%)
coiled coil 287..338 CDD:269848 22/49 (45%)
Atf1NP_001094365.1 pKID 47..81 CDD:396650
bZIP_CREB1 212..266 CDD:269838 23/50 (46%)
coiled coil 213..264 CDD:269838 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.