DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Atf1

DIOPT Version :10

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001094365.1 Gene:Atf1 / 315305 RGDID:1307360 Length:268 Species:Rattus norvegicus


Alignment Length:101 Identity:33/101 - (32%)
Similarity:50/101 - (49%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SNIVIKKKNATFIQSLK-ESTPSHT--------------------MDDKIYKKYQRMIKNRESAS 299
            ||.|:.:..:..:|:.: .:|||.|                    .||...|:..|::||||:|.
  Rat   161 SNQVVVQTASGDMQTYQIRTTPSATSLPQTMVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR 225

  Fly   300 LSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            ..|:|:||||..||.|:..||.:..:|..|..||:|
  Rat   226 ECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 22/49 (45%)
coiled coil 287..338 CDD:269848 22/49 (45%)
Atf1NP_001094365.1 pKID 47..81 CDD:396650
bZIP_CREB1 212..266 CDD:269838 23/50 (46%)
coiled coil 213..265 CDD:269838 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.