DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Creb3l4

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001007094.1 Gene:Creb3l4 / 310616 RGDID:1359278 Length:367 Species:Rattus norvegicus


Alignment Length:376 Identity:80/376 - (21%)
Similarity:143/376 - (38%) Gaps:104/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SNVNGCSNEEAVYPLLVDSDKF-DPFFEPAKVR----SPNKEFNSTISNLSDIKNELPE--TSQD 181
            |.|.|....|        ||.| :.|.:|..:|    ||..:  |.:|  .|..:..|:  :|..
  Rat    31 SKVPGLQKSE--------SDDFLNLFIDPNMIRCSETSPGSD--SGVS--EDPGSPAPQAPSSPA 83

  Fly   182 LGFNSYNTSRNNSTLTKSWPI--NTELNLDNQVPKTVLPLSRTIY-LPSHDYKGLLPTV------ 237
            |....|.......|..::.|.  ...:.:|...|..::|.:.|:. |||..::.:||.|      
  Rat    84 LYEVVYEAGALQGTQREAGPTFGLISIQIDQWSPAFMVPGACTVSDLPSEAHRHILPRVSTIAPP 148

  Fly   238 ------KCNGDRTLKKNVNVRSKISNIVIKKKNATFIQSLKESTPSH----TMDDKIYKKYQRMI 292
                  .|                ..:.:..:....:.....:.|||    ..:::|.||.:|.|
  Rat   149 PPAALLSC----------------QRLFLTDEEKHLLGQEGVTLPSHLPLTKAEERILKKIRRKI 197

  Fly   293 KNRESASLSRKKRKEYVVSLETRI-------NKLEKECDSLKAENITLRDQIFLLATSCQRESGN 350
            :|::||..||:::|||:..||:|:       .||:::...|:.:||:|..|:..|.         
  Rat   198 RNKQSAQDSRRRKKEYIDGLESRVAACSEQNQKLQRKVQELERQNISLVAQVHQLQ--------- 253

  Fly   351 ANGLLHNYSGSERSENKNGRFTSKAKHCNKNNTTATIKKNVAILFAMAFVVSLNAGNFQKYLNIP 415
                               :||::........:|..:    .:||::|.::..:...||      
  Rat   254 -------------------KFTAQTSSRAAQTSTCVL----ILLFSLALIILPSFSPFQ------ 289

  Fly   416 NNLEGKSEIEPVGKQL-SMSNRRLLWADSEEEYKEKNNLSTFLSGKQKEPS 465
            :..|.:||    |.|| .:.:|.:|..:...|..|...|...|....:.|:
  Rat   290 SQPEARSE----GYQLHGVISRNILTHEDMTESPESPVLKANLEELPQVPA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/57 (37%)
coiled coil 287..338 CDD:269848 21/57 (37%)
Creb3l4NP_001007094.1 Required for transcriptional activation. /evidence=ECO:0000250 1..52 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..81 6/26 (23%)
bZIP_CREB3 190..250 CDD:269837 22/59 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 191..230 15/38 (39%)
coiled coil 192..243 CDD:269837 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 231..252 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.