DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Creb3

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001382561.1 Gene:Creb3 / 298400 RGDID:1308831 Length:387 Species:Rattus norvegicus


Alignment Length:398 Identity:86/398 - (21%)
Similarity:154/398 - (38%) Gaps:111/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ETSQDLGFNSYNTSRNNSTLTKSWPINTELN--LDNQVPKTVLPLSRTIYLPSHDYKGLLP---- 235
            ||..||   ..:.|.|:......|.:...|:  |.......||..|.:..|..|:|.  ||    
  Rat    48 ETPLDL---ELSPSENSVQELSDWEVEDLLSSLLSPSSSPDVLNSSSSSILHDHNYS--LPQEHV 107

  Fly   236 -------TVKCNGDRTLKKNVN---VRSKISNIVIKKKNATFIQ----SLKESTPSHTMDDKIYK 286
                   :.:..|.|.....|.   ...::|.:::.::....::    :|..:.|...:::::.|
  Rat   108 SIDLDPGSFEKEGFRMNPLRVEETAAEQELSTLILTEEEKRLLEKEGLTLPSTLPLTKVEEQVLK 172

  Fly   287 KYQRMIKNRESASLSRKKRKEYVVSLETRINK-------LEKECDSLKAENITLRDQIFLLATSC 344
            :.:|.|:|:.:|..||||:|.|||.||:|:.|       |:.:...|:.:|::|.||:..|....
  Rat   173 RVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNQELQNKVQHLEEQNLSLLDQLRKLQAMV 237

  Fly   345 QRESGNANGLLHNYSGSERSENKNGRFTSKAKHCNKNNTTATIKKNVAILFAMAFVVSLNAGNFQ 409
                                          .:..||.::.:|....:.:.|.:..|.::.:    
  Rat   238 ------------------------------TEIANKTSSGSTCVLVLLLSFCLLLVPAMYS---- 268

  Fly   410 KYLNIPNNLEGKSEIEPVGKQLSMSNRRLLWADSEEEYKEKNNLSTFLSGKQKEPSLYFLNSGIR 474
                  :::.|....|.|     :.:|:|....||::::.|      ||..|.|     |..|..
  Rat   269 ------SDVRGSVPAEYV-----VLHRKLRALPSEDQHQPK------LSALQPE-----LPMGST 311

  Fly   475 NHKINSFEN---ITKNVS---HTYSYNEPP--PLTYLSTRNCINRCRSHNGSSNQSKYFMLAQNL 531
            | ::.|.|:   ...|||   |.....:||  ||..||:.      ...:||.     .:|..||
  Rat   312 N-QLESSEHTFLAPSNVSCLNHMAQTEQPPHWPLLDLSSE------MPFSGSD-----LLLQANL 364

  Fly   532 HK---WIS 536
            .:   |:|
  Rat   365 TESGGWLS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 22/57 (39%)
coiled coil 287..338 CDD:269848 22/57 (39%)
Creb3NP_001382561.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.