DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Crem

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001104330.1 Gene:Crem / 25620 RGDID:2402 Length:357 Species:Rattus norvegicus


Alignment Length:387 Identity:75/387 - (19%)
Similarity:131/387 - (33%) Gaps:100/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYNLYNDLSLLGEVTENNYDNNIVHDILNSSAFYNDTSLDLSELIPDL-QKEAFGLHFSSNPITS 68
            :|...|...:..|..|:..|.::.|.:...|:.:..|. .:|  :|.| |....|         |
  Rat     8 KYMRTNVRQMTMETVESQQDRSVTHSVAEHSSAHMQTG-QIS--VPTLAQVSVAG---------S 60

  Fly    69 EFSLSSPISGLKQIPSACSGEFKRNVNDNNFQLDLTNSRNDLPEPNSSPTRSLNRSNVNGCSNEE 133
            .....||...|.|:||..:.:.:..:.        |...:.:..|.....:....:..:..::.|
  Rat    61 GTGRGSPAVTLVQLPSGQTVQVQGVIQ--------TPHPSVIQSPQIQTVQVATIAETDDSADSE 117

  Fly   134 AVYPLLVDSDKFDPFFEPAKVRSPN-----KEFNSTISNLSDIKNE---------------LPET 178
                 ::||.|......    |.|:     .|.:|.:..:..|:.|               :|.:
  Rat   118 -----VIDSHKRREILS----RRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTS 173

  Fly   179 SQDLGFNSYNTSRNNSTLTKSWPIN------TELNLDNQ------------------------VP 213
            ........|.......|:..|.|.:      ..|.:.|.                        ||
  Rat   174 IYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVP 238

  Fly   214 --KTVLPLSRTIYLPSH--DYKGLLPTVKCNGDRT-LKKNVNVRSKISNIVIKKKNATFIQSLKE 273
              :.|:....|...|||  ...|.:||.:.....| |.:.|.:.:...::               
  Rat   239 GSQVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSL--------------- 288

  Fly   274 STPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            .:|....::...|:..|::||||:|...|:|:||||..||.|:..||.:..:|..|...|:|
  Rat   289 HSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
CremNP_001104330.1 pKID 112..151 CDD:396650 8/47 (17%)
bZIP_CREB1 301..355 CDD:269838 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.