DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and CREB3L4

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001242907.1 Gene:CREB3L4 / 148327 HGNCID:18854 Length:395 Species:Homo sapiens


Alignment Length:346 Identity:67/346 - (19%)
Similarity:131/346 - (37%) Gaps:98/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VDSDKFDPFFEPAKVRSPNKEFNSTISNLSDIKNELPETSQDLGFNSYNTSR-------NNSTLT 197
            :..|...|...||...:.:......:.....::....||..::|..|....:       .:|.:.
Human    91 ISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMV 155

  Fly   198 KSWPINTELNLDNQVPK--TVLPLSRTIYLPSHDYKGLLPTVKCNGDRTLKKNVNVRSKISNIVI 260
            ...|.:...::   :|:  ||.|:..|..||            |                ..:.:
Human   156 SELPFDAHAHI---LPRAGTVAPVPCTTLLP------------C----------------QTLFL 189

  Fly   261 KKKNATFIQSLKESTPSH----TMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRI----- 316
            ..:....:.....|.|||    ..::::.||.:|.|:|::||..||:::|||:..||:|:     
Human   190 TDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSA 254

  Fly   317 --NKLEKECDSLKAENITLRDQIFLLATSCQRESGNANGLLHNYSGSERSENKNGRFTSKAKHCN 379
              .:|:|:...|:..||:|..|:..|.|...:.|                              |
Human   255 QNQELQKKVQELERHNISLVAQLRQLQTLIAQTS------------------------------N 289

  Fly   380 KNNTTATIKKNVAILFAMAFVVSLNAGNFQKYLNIPNNLEGKSEIEPVGKQLSMSNRRLLWADSE 444
            |...|:|..  :.:||::|.::   ..:|..:.:.|.  .|..:.:|.|    :::|.:|   :.
Human   290 KAAQTSTCV--LILLFSLALII---LPSFSPFQSRPE--AGSEDYQPHG----VTSRNIL---TH 340

  Fly   445 EEYKEKNNLST-FLSGKQKEP 464
            ::..|  ||.| .:..:.:||
Human   341 KDVTE--NLETQVVESRLREP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/57 (37%)
coiled coil 287..338 CDD:269848 21/57 (37%)
CREB3L4NP_001242907.1 PCC 77..>154 CDD:188093 9/62 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..108 4/16 (25%)
bZIP_CREB3 218..278 CDD:269837 22/59 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 219..248 14/28 (50%)
coiled coil 220..271 CDD:269837 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 259..280 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..395 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.