DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and CREM

DIOPT Version :10

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_047280581.1 Gene:CREM / 1390 HGNCID:2352 Length:361 Species:Homo sapiens


Alignment Length:61 Identity:23/61 - (37%)
Similarity:37/61 - (60%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 TPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
            :|....::...|:..|::||||:|...|:::||||..||:|:..||.:...|..|..||:|
Human   293 SPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
CREMXP_047280581.1 pKID 118..154 CDD:396650
bZIP_CREB1 304..358 CDD:269838 22/50 (44%)
coiled coil 305..357 CDD:269838 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.