DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and Crem

DIOPT Version :10

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001104329.1 Gene:Crem / 12916 MGIID:88495 Length:357 Species:Mus musculus


Alignment Length:129 Identity:36/129 - (27%)
Similarity:59/129 - (45%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VP--KTVLPLSRTIYLPSH--DYKGLLPTVKCNGDRT-LKKNVNVRSKISNIVIKKKNATFIQSL 271
            ||  :.|:....|...|||  ...|.:||.:.....| |.:.|.:.:...::             
Mouse   237 VPGSQVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSL------------- 288

  Fly   272 KESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRD 335
              .:|....::...|:..|::||||:|...|:::||||..||:|:..||.:...|..|..||:|
Mouse   289 --HSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/49 (43%)
coiled coil 287..338 CDD:269848 21/49 (43%)
CremNP_001104329.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
pKID 112..151 CDD:396650
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 300..325 11/24 (46%)
bZIP_CREB1 301..355 CDD:269838 22/50 (44%)
coiled coil 302..354 CDD:269838 21/49 (43%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 327..348 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.