DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and CREB3

DIOPT Version :10

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_006359.3 Gene:CREB3 / 10488 HGNCID:2347 Length:371 Species:Homo sapiens


Alignment Length:209 Identity:53/209 - (25%)
Similarity:96/209 - (45%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 DIKNELPETSQDLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPK---------TVL--PLSRTI 223
            |:...|.|.|.|||     |:.:.:...   |::..|.| ::||.         ::|  |.|..|
Human    11 DLLAFLLEESGDLG-----TAPDEAVRA---PLDWALPL-SEVPSDWEVDDLLCSLLSPPASLNI 66

  Fly   224 Y------LPSHDYKGLLP--TVKCN---------GDRTLKKNVN--VRSKISNIVIKKKNATFIQ 269
            .      |..||:...||  ||..:         |.:...:::.  ...:|:.:|:..:..:.::
Human    67 LSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLE 131

  Fly   270 S----LKESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINK-------LEKEC 323
            .    |.|:.|....:::|.|:.:|.|:|:.||..||:|:|.||..||:|:.|       |:.:.
Human   132 KEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKV 196

  Fly   324 DSLKAENITLRDQI 337
            ..|:.:|::|.||:
Human   197 QLLEEQNLSLLDQL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/58 (36%)
coiled coil 287..338 CDD:269848 21/58 (36%)
CREB3NP_006359.3 Transcription activation (acidic). /evidence=ECO:0000269|PubMed:10984507 1..92 24/89 (27%)
LXXLL motif 1 13..17 0/3 (0%)
LXXLL motif 2 54..58 0/3 (0%)
HCFC1-binding-motif (HBM) 78..81 1/2 (50%)
bZIP_CREB3 151..211 CDD:269837 22/60 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 152..184 15/31 (48%)
coiled coil 153..204 CDD:269837 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 192..213 6/19 (32%)

Return to query results.
Submit another query.