DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf6 and creb3l3b

DIOPT Version :9

Sequence 1:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_009297197.2 Gene:creb3l3b / 100538072 ZFINID:ZDB-GENE-131023-1 Length:388 Species:Danio rerio


Alignment Length:436 Identity:87/436 - (19%)
Similarity:140/436 - (32%) Gaps:160/436 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DTSLDLSELIPDLQKEAFGLHFSSNPITSEFSLSSPISGLKQIPSACSGEFKRNVNDNNFQLDLT 104
            |:.||:|:              ..:|..|..|..||...|...|.:.|..|..           .
Zfish    57 DSLLDMSK--------------PCSPCDSGISDDSPSECLDSPPPSASSAFSS-----------V 96

  Fly   105 NSRNDLP--EPNSSPTRSLNRSNVNGCSNEEAVYPLLVDSDKFDPFFEPAKVRS-PNKEFNSTIS 166
            .....||  :.|:.|..|::.::...|         |......||.|..|.|:| |...:..|:.
Zfish    97 FLHQPLPQQDTNTEPDFSIDLADWEAC---------LFSDSLTDPQFPSAVVKSQPAAVYQLTVK 152

  Fly   167 NLSDIKNELPET------SQDLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRTIYL 225
            :|.......|.|      ||.|..|.                                       
Zfish   153 DLLLSSTAEPSTKPSTQQSQHLILND--------------------------------------- 178

  Fly   226 PSHDYKGLLPTVKCNGDRTLKKNVNVRSKISNIVIKKKNATFIQSLKESTPSHTMDDKIYKKYQR 290
               |.|.||          .|:.|::.|::                    |.:..::|:.||.:|
Zfish   179 ---DEKKLL----------AKEGVSLPSQL--------------------PLNKYEEKVLKKIRR 210

  Fly   291 MIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRDQIFLLA---TSCQRESGNAN 352
            .|:|::||..||||:|||:..||.|:       .:..|.|:.|:.::..|.   ||...:.....
Zfish   211 KIRNKQSAQESRKKKKEYIDGLEGRM-------AACSAHNLDLQRKVLQLEKTNTSLMEQLRRLQ 268

  Fly   353 GLLHNYSGSERSENKNGRFTSKAKHCNKNNTTATIKKNVAILFAMAFVVSL---------NAGNF 408
            .||.:.||                   |...|.|....:.:.|::..:.||         :.|:.
Zfish   269 ALLMSGSG-------------------KPAQTGTCILVLVLSFSLILIPSLQPISHRRAADPGDI 314

  Fly   409 QKYLNIPNNLEGKSEIEPV--GKQLSMSNRRLL-----WADSEEEY 447
            ........:|....|:..:  |...|.||:..|     :||.::.:
Zfish   315 STAKVQSRSLRSVMEVYSISRGVDTSSSNQNALLTRPEYADMDQSH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 19/50 (38%)
coiled coil 287..338 CDD:269848 19/50 (38%)
creb3l3bXP_009297197.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.