DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and SPSB2

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001139788.1 Gene:SPSB2 / 84727 HGNCID:29522 Length:263 Species:Homo sapiens


Alignment Length:277 Identity:137/277 - (49%)
Similarity:170/277 - (61%) Gaps:15/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQ-KISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASRDLQLKHSWNSEDRS 64
            ||| .::||        |.||  | .|:.|..|...|..::.||..||.....|.:|.||.:|.|
Human     1 MGQTALAGG--------SSST--P-TPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCS 54

  Fly    65 LNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSV 129
            .||.|||.. |.|.|.|||||||..|||.|.::|||.|||.||..||||||||||.||.|||.:.
Human    55 ENIEVKEGG-LYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTD 118

  Fly   130 GYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIV 194
            .|.:|:||..:|||||:||.||||.||......|||..:. |...||::.||.|||:||||.:.:
Human   119 HYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQG-EQLEVPERLLVVLDMEEGTLGYAI 182

  Fly   195 DQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEPLPLMDLCRRTIRQKIGRTNLEEH 259
            ...|||.|||||:|:.|||.||||||.|::.:||:|....||..|:.|.|..:|..:|.|.|.: 
Human   183 GGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQ- 246

  Fly   260 IQQLQLPLSMKTYLLYK 276
            :..|.||.:||.||||:
Human   247 VSALPLPPAMKRYLLYQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 99/172 (58%)
SOCS_SSB1_4 234..276 CDD:239688 17/41 (41%)
SPSB2NP_001139788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 19/57 (33%)
SPRY_SOCS1-2-4 46..217 CDD:293963 99/172 (58%)
SOCS_SSB2 222..263 CDD:239689 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D399707at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.