DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and SP555

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:126/272 - (46%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASRDLQLKHSWNSEDRSLNIFV 69
            ::||:.:.|.:.|.||..|  ||                 ..|....::...:|:...||..:.:
  Fly    33 VTGGLSSGSLDASSSTSPP--PR-----------------FCPLPNGVEDNWTWSKRHRSKEVVL 78

  Fly    70 KEDDKLTFHRHP-VAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQS 133
            :..:..|.|.|| .::.|..::||..|..|.|.||::...|..||..:.|:.|..|.||:..:::
  Fly    79 RGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRN 143

  Fly   134 LVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQY 198
            ::|..|..||.. .:..|:|:.   ..:.|....:.::    |.:..|..|..||||:|..|.:.
  Fly   144 MLGENEHGWGLS-HKGVLWHEG---VALLYTKRFRENQ----PTQIGVLFDGIEGTLTFYKDGKC 200

  Fly   199 LGIAFRGLR--GKKLYPIVSAVWGHCEITMRYIGGLDPEPLPLMDLCRRTIRQKIGRTNLEEHIQ 261
            ||:|||||.  .:.|||||.:.....|:|::.   ...|.:.|.|.||..|.:   |......::
  Fly   201 LGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKC---TRREFVNLQDRCRAVIMR---RVRSAAQLE 259

  Fly   262 QLQLPLSMKTYL 273
            :|:|||.:..||
  Fly   260 KLKLPLPIADYL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 53/175 (30%)
SOCS_SSB1_4 234..276 CDD:239688 13/40 (33%)
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 58/195 (30%)
SOCS 240..273 CDD:295349 12/35 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.