DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and CG10516

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:95/229 - (41%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WNSEDRSLNIFVKEDDKLTFHRHPV-AQSTDCIRGKVGL-TKGLHIWEIYWPTRQRGTHAVVGVC 120
            |::.|.|..:....|  :.|  ||. :|.|..:||:..| |..:|.||:...|...||..:.|:.
  Fly    53 WHATDESDAVVTDRD--IIF--HPTYSQGTAIVRGEQALKTNMVHFWEMRVITTLAGTDVMFGIG 113

  Fly   121 TADAPLHSVGYQ--SLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVAL 183
            |....|....:.  |.:|:..||||:... .::.|     .|...|...|..:..|:.    |.|
  Fly   114 TESVNLGQFKFHFVSALGTNAQSWGFSYS-GRIQH-----CGELLPYGQKFSQGCLIG----VCL 168

  Fly   184 DMDEGTLSFIVDQQYLGIAFRGL---RGKKLYPIVSAVWG-------HC-----EITMRYIGGLD 233
            |...|.|.|.::::.||:|:..:   ...|:||:|.:...       :|     .:.:|....|.
  Fly   169 DRTRGHLEFYLNRRSLGVAYTNVPTDPDVKIYPMVCSTAAKSVIRLINCTSQPVTLQLRSFQALS 233

  Fly   234 PEPLPLMDLCRRTIRQKIGRTNLEEHIQQLQLPL 267
            .:||.|.:|     ||..|...:.:....|..|:
  Fly   234 RQPLKLAEL-----RQMPGLKGIMQSYWFLAPPI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 48/189 (25%)
SOCS_SSB1_4 234..276 CDD:239688 9/34 (26%)
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 48/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.