DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and Spsb3

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_017452710.1 Gene:Spsb3 / 302981 RGDID:1310936 Length:447 Species:Rattus norvegicus


Alignment Length:243 Identity:65/243 - (26%)
Similarity:105/243 - (43%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WNSEDRSLNIFVKEDD-KLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCT 121
            |:..::|....:..|: |::||.. .:..|..|||...|..|.|.|||...:...||..:||:.|
  Rat   173 WDDLNKSSATLLSCDNRKVSFHME-YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGT 236

  Fly   122 ADAPL----HSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTY-----------PAIL---- 167
            :|..|    |:  :.||:|..|.|||       |.:..:.|.|..:           |.:|    
  Rat   237 SDVDLDKYHHT--FCSLLGRDEDSWG-------LSYTGRCCLGYGWGWQCHRPPRLTPLLLTGLL 292

  Fly   168 --KNDEA-----FLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEIT 225
              |.|:.     |.......|.||...|||:|..:::.:|:|...|:.::.||:|.:.  ..:.:
  Rat   293 HHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQNRRFYPMVCST--AAKSS 355

  Fly   226 MRYIGGLDPEPLPLMDLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYL 273
            |:.|... .....|..||...:||.  |.:..:.::.|.||..:|..|
  Rat   356 MKVIRSC-ASSTSLQYLCCYRLRQL--RPDSGDTLEGLPLPPGLKQVL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 53/197 (27%)
SOCS_SSB1_4 234..276 CDD:239688 11/40 (28%)
Spsb3XP_017452710.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.